PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00521.1.g00010.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 86aa    MW: 9688.09 Da    PI: 10.828
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00521.1.g00010.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF916e-293483251
                                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                  rienk+ rqvtf+kRrng+lKKA+ELS+LCdaeva+++fs+ g+ly +ss
  Zpz_sc00521.1.g00010.1.am.mk 34 RIENKISRQVTFAKRRNGLLKKAYELSILCDAEVALVLFSHAGRLYQFSS 83
                                  9***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554553.14E-272585IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.022585IPR002100Transcription factor, MADS-box
SMARTSM004322.9E-362584IPR002100Transcription factor, MADS-box
CDDcd002651.16E-352685No hitNo description
PRINTSPR004045.9E-302747IPR002100Transcription factor, MADS-box
PROSITE patternPS0035002781IPR002100Transcription factor, MADS-box
PfamPF003191.3E-263481IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-304762IPR002100Transcription factor, MADS-box
PRINTSPR004045.9E-306283IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 86 aa     Download sequence    Send to blast
MLAEGPTDRF GEGDRRRGEQ DRSGMGRGKV VLQRIENKIS RQVTFAKRRN GLLKKAYELS  60
ILCDAEVALV LFSHAGRLYQ FSSSSK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S2e-202584160Myocyte-specific enhancer factor 2B
1tqe_R2e-202584160Myocyte-specific enhancer factor 2B
1tqe_Q2e-202584160Myocyte-specific enhancer factor 2B
1tqe_P2e-202584160Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0424068e-90BT042406.1 Zea mays full-length cDNA clone ZM_BFb0221D10 mRNA, complete cds.
GenBankEU9617998e-90EU961799.1 Zea mays clone 238290 MADS-box transcription factor 34 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002463863.11e-36hypothetical protein SORBIDRAFT_01g007780
RefseqXP_004981738.14e-36PREDICTED: MADS-box transcription factor 34
RefseqXP_004981739.14e-36PREDICTED: MADS-box transcription factor 34
SwissprotQ6Q9H61e-37MAD34_ORYSJ; MADS-box transcription factor 34
TrEMBLC5X0932e-36C5X093_SORBI; Putative uncharacterized protein Sb01g007780
TrEMBLK4AE904e-36K4AE90_SETIT; Uncharacterized protein
TrEMBLQ84KI24e-37Q84KI2_SORBI; MADS box protein AGLG1 (Fragment)
TrEMBLQ84U973e-36Q84U97_LOLPR; MADS7
STRINGSi037197m1e-35(Setaria italica)
STRINGSb01g007780.15e-36(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03710.32e-31MIKC_MADS family protein